PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G09770.1
Common NameATCDC5, ATMYBCDC5, CDC5, F21M12.15, MAC1, MYBCD5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 844aa    MW: 95766.6 Da    PI: 6.7307
Description cell division cycle 5
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G09770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.2e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      AT1G09770.1  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding34.45.1e-1160103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k+l++  W+tIa  +g  Rt+ qc +r+ k+l
      AT1G09770.1  60 TEWTREEDEKLLHLAKLLPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139214.3E-131070No hitNo description
CDDcd001671.54E-111053No hitNo description
SuperFamilySSF466898.63E-2133108IPR009057Homeodomain-like
CDDcd116594.91E-3055106No hitNo description
Gene3DG3DSA:1.10.10.605.7E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.67558107IPR017930Myb domain
SMARTSM007172.3E-1258105IPR001005SANT/Myb domain
PfamPF118316.2E-58407655IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0006397Biological ProcessmRNA processing
GO:0007049Biological Processcell cycle
GO:0008380Biological ProcessRNA splicing
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0030154Biological Processcell differentiation
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005681Cellular Componentspliceosomal complex
GO:0009507Cellular Componentchloroplast
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 844 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLLPTQ WRTIAPIVGR TPSQCLERYE KLLDAACTKD ENYDAADDPR  120
KLRPGEIDPN PEAKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDGRHR KRKRKGIDYN AEIPFEKRAP AGFYDTADED RPADQVKFPT  240
TIEELEGKRR ADVEAHLRKQ DVARNKIAQR QDAPAAILQA NKLNDPEVVR KRSKLMLPPP  300
QISDHELEEI AKMGYASDLL AENEELTEGS AATRALLANY SQTPRQGMTP MRTPQRTPAG  360
KGDAIMMEAE NLARLRDSQT PLLGGENPEL HPSDFTGVTP RKKEIQTPNP MLTPSMTPGG  420
AGLTPRIGLT PSRDGSSFSM TPKGTPFRDE LHINEDMDMH ESAKLERQRR EEARRSLRSG  480
LTGLPQPKNE YQIVAQPPPE ESEEPEEKIE EDMSDRIARE KAEEEARQQA LLKKRSKVLQ  540
RDLPRPPAAS LAVIRNSLLS ADGDKSSVVP PTPIEVADKM VREELLQLLE HDNAKYPLDD  600
KAEKKKGAKN RTNRSASQVL AIDDFDENEL QEADKMIKEE GKFLCVSMGH ENKTLDDFVE  660
AHNTCVNDLM YFPTRSAYEL SSVAGNADKV AAFQEEMENV RKKMEEDEKK AEHMKAKYKT  720
YTKGHERRAE TVWTQIEATL KQAEIGGTEV ECFKALKRQE EMAASFRKKN LQEEVIKQKE  780
TESKLQTRYG NMLAMVEKAE EIMVGFRAQA LKKQEDVEDS HKLKEAKLAT GEEEDIAIAM  840
EASA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10132242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDGRHRKRKRK
2199204RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.2780.0bud| flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306813440.0
Genevisible264709_at0.0
Expression AtlasAT1G09770-
AtGenExpressAT1G09770-
ATTED-IIAT1G09770-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed extensively in shoot and root meristems. {ECO:0000269|PubMed:8917598}.
Functional Description ? help Back to Top
Source Description
TAIRMember of MYB3R- and R2R3- type MYB- encoding genes. Essential for plant innate immunity. Interacts with MOS4 and PRL1.
UniProtComponent of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}.
Function -- GeneRIF ? help Back to Top
  1. Silencing of AtCDC5 in wild-type plants all induces cell death.
    [PMID: 17298883]
  2. These results suggest that AtCDC5 is essential for the G2/M phase transition and may regulate the function of SAM by controlling the expression of STM and WUS.
    [PMID: 17768399]
  3. Results suggest that CDC5 may have dual roles in miRNA biogenesis: functioning as a positive transcription factor of MIR and/or acting as a component of the DICER-LIKE1 complex to enhance primary miRNA processing.
    [PMID: 24101471]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEX16381825Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G09770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G62360(A), AT1G75820(A), AT2G17950(A), AT2G27250(A), AT3G54180(A), AT4G16890(A)
Interaction ? help Back to Top
Source Intact With
IntActSearch P92948
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Accelerated cell death. Enhanced susceptibility to virulent and avirulent pathogens. {ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G09770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0930570.0AY093057.1 Arabidopsis thaliana putative Myb DNA-binding protein (At1g09770) mRNA, complete cds.
GenBankBT0088010.0BT008801.1 Arabidopsis thaliana At1g09770 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172448.10.0cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLD7KJT90.0D7KJT9_ARALL; MYB transcription factor
STRINGAT1G09770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64532742
Representative plantOGRP39481723
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Kleffmann T, et al.
    The Arabidopsis thaliana chloroplast proteome reveals pathway abundance and novel protein functions.
    Curr. Biol., 2004. 14(5): p. 354-62
    [PMID:15028209]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Lin Z, et al.
    Virus induced gene silencing of AtCDC5 results in accelerated cell death in Arabidopsis leaves.
    Plant Physiol. Biochem., 2007. 45(1): p. 87-94
    [PMID:17298883]
  7. Palma K, et al.
    Regulation of plant innate immunity by three proteins in a complex conserved across the plant and animal kingdoms.
    Genes Dev., 2007. 21(12): p. 1484-93
    [PMID:17575050]
  8. Lin Z, et al.
    AtCDC5 regulates the G2 to M transition of the cell cycle and is critical for the function of Arabidopsis shoot apical meristem.
    Cell Res., 2007. 17(9): p. 815-28
    [PMID:17768399]
  9. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  10. Monaghan J, et al.
    Two Prp19-like U-box proteins in the MOS4-associated complex play redundant roles in plant innate immunity.
    PLoS Pathog., 2009. 5(7): p. e1000526
    [PMID:19629177]
  11. Monaghan J,Xu F,Xu S,Zhang Y,Li X
    Two putative RNA-binding proteins function with unequal genetic redundancy in the MOS4-associated complex.
    Plant Physiol., 2010. 154(4): p. 1783-93
    [PMID:20943852]
  12. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  13. Pellino M,Sharbel TF,Mau M,Amiteye S,Corral JM
    Selection of reference genes for quantitative real-time PCR expression studies of microdissected reproductive tissues in apomictic and sexual Boechera.
    BMC Res Notes, 2011. 4: p. 303
    [PMID:21851639]
  14. Xu F,Xu S,Wiermer M,Zhang Y,Li X
    The cyclin L homolog MOS12 and the MOS4-associated complex are required for the proper splicing of plant resistance genes.
    Plant J., 2012. 70(6): p. 916-28
    [PMID:22248079]
  15. Zhang S,Xie M,Ren G,Yu B
    CDC5, a DNA binding protein, positively regulates posttranscriptional processing and/or transcription of primary microRNA transcripts.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(43): p. 17588-93
    [PMID:24101471]
  16. Fujiwara M, et al.
    Interactomics of Qa-SNARE in Arabidopsis thaliana.
    Plant Cell Physiol., 2014. 55(4): p. 781-9
    [PMID:24556609]
  17. Zhang S,Liu Y,Yu B
    PRL1, an RNA-binding protein, positively regulates the accumulation of miRNAs and siRNAs in Arabidopsis.
    PLoS Genet., 2014. 10(12): p. e1004841
    [PMID:25474114]
  18. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  19. Hirayama T,Shinozaki K
    A cdc5+ homolog of a higher plant, Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 1996. 93(23): p. 13371-6
    [PMID:8917598]